SCOPe 2.06: Domain d1uuwb_: 1uuw B:

Lineage for d1uuwb_ (1uuw B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)

8. Domain d1uuwb_: 1uuw B: [119704]
   Other proteins in same PDB: d1uuwa1, d1uuwa2
   automated match to d1eg9b_
   complexed with fe, fes, no, so4

Details for d1uuwb_

PDB Entry: 1uuw, 2.3 Å

PDB Description: naphthalene 1,2-dioxygenase with nitric oxide bound in the active site.

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1uuwb_:

Sequence; same for both SEQRES and ATOM records:

>d1uuwb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

Timeline for d1uuwb_:

• d1uuwb_ first appeared in SCOP 1.73, called d1uuwb1
  
• d1uuwb_ appears in SCOPe 2.05
  
• d1uuwb_ appears in SCOPe 2.07
  
• d1uuwb_ appears in the current release, SCOPe 2.08