SCOPe 2.05: Domain d1uuvb_: 1uuv B:

Lineage for d1uuvb_ (1uuv B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)

8. Domain d1uuvb_: 1uuv B: [119701]
   Other proteins in same PDB: d1uuva1, d1uuva2
   automated match to d1eg9b_
   complexed with edo, fe, fes, ind, no, so4

Details for d1uuvb_

PDB Entry: 1uuv, 1.65 Å

PDB Description: naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1uuvb_:

Sequence; same for both SEQRES and ATOM records:

>d1uuvb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

Timeline for d1uuvb_:

• d1uuvb_ first appeared in SCOP 1.73, called d1uuvb1
  
• d1uuvb_ appears in SCOPe 2.04
  
• d1uuvb_ appears in SCOPe 2.06
  
• d1uuvb_ appears in the current release, SCOPe 2.08