| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
| Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species) |
| Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries) |
| Domain d1uuvb_: 1uuv B: [119701] Other proteins in same PDB: d1uuva1, d1uuva2 automated match to d1eg9b_ complexed with edo, fe, fes, ind, no, so4 |
PDB Entry: 1uuv (more details), 1.65 Å
SCOPe Domain Sequences for d1uuvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuvb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl
Timeline for d1uuvb_: