Lineage for d1uuva1 (1uuv A:1-154)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782462Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2782494Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. 2782495Species Pseudomonas putida [TaxId:303] [50035] (10 PDB entries)
  8. 2782498Domain d1uuva1: 1uuv A:1-154 [119699]
    Other proteins in same PDB: d1uuva2, d1uuvb_
    automated match to d1o7na1
    complexed with edo, fe, fes, ind, no, so4

Details for d1uuva1

PDB Entry: 1uuv (more details), 1.65 Å

PDB Description: naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d1uuva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuva1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d1uuva1:

Click to download the PDB-style file with coordinates for d1uuva1.
(The format of our PDB-style files is described here.)

Timeline for d1uuva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uuva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uuvb_