Lineage for d1ut6a1 (1ut6 A:4-535)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 841868Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 841869Protein Acetylcholinesterase [53476] (5 species)
  7. 841925Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (68 PDB entries)
    Uniprot P04058 25-556
  8. 841971Domain d1ut6a1: 1ut6 A:4-535 [119698]
    automatically matched to d1eve__
    complexed with a8n, nag

Details for d1ut6a1

PDB Entry: 1ut6 (more details), 2.4 Å

PDB Description: structure of acetylcholinesterase (e.c. 3.1.1.7) complexed with n-9- (1',2',3',4'-tetrahydroacridinyl)-1,8- diaminooctane at 2.4 angstroms resolution.
PDB Compounds: (A:) acetylcholinesterase

SCOP Domain Sequences for d1ut6a1:

Sequence, based on SEQRES records: (download)

>d1ut6a1 c.69.1.1 (A:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d1ut6a1 c.69.1.1 (A:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1ut6a1:

Click to download the PDB-style file with coordinates for d1ut6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ut6a1: