Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47520] (10 PDB entries) mutant with a two residue deletion in the central helix |
Domain d1up5a_: 1up5 A: [119696] automated match to d1cfc__ complexed with ca |
PDB Entry: 1up5 (more details), 1.9 Å
SCOPe Domain Sequences for d1up5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up5a_ a.39.1.5 (A:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvqmmtak
Timeline for d1up5a_: