Lineage for d1ul1c1 (1ul1 C:1-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1041062Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1041084Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1041105Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
    Uniprot P12004
  8. 1041142Domain d1ul1c1: 1ul1 C:1-126 [119688]
    Other proteins in same PDB: d1ul1x1, d1ul1x2, d1ul1y1, d1ul1y2, d1ul1z1, d1ul1z2
    automatically matched to d1axca1
    protein/DNA complex; complexed with mg

Details for d1ul1c1

PDB Entry: 1ul1 (more details), 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1ul1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul1c1 d.131.1.2 (C:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d1ul1c1:

Click to download the PDB-style file with coordinates for d1ul1c1.
(The format of our PDB-style files is described here.)

Timeline for d1ul1c1: