SCOP 1.75: Domain d1ul1b2: 1ul1 B:127-255

Lineage for d1ul1b2 (1ul1 B:127-255)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
   Uniprot P12004

8. Domain d1ul1b2: 1ul1 B:127-255 [119687]
   Other proteins in same PDB: d1ul1x1, d1ul1x2, d1ul1y1, d1ul1y2, d1ul1z1, d1ul1z2
   automatically matched to d1axca2
   complexed with mg

Details for d1ul1b2

PDB Entry: 1ul1, 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1ul1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ul1b2 d.131.1.2 (B:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Timeline for d1ul1b2:

• d1ul1b2 first appeared in SCOP 1.73
  
• d1ul1b2 appears in SCOPe 2.01
  
• d1ul1b2 appears in the current release, SCOPe 2.08