Class a: All alpha proteins [46456] (258 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.5: IscX-like [140319] (1 family) |
Family a.159.5.1: IscX-like [140320] (1 protein) Pfam PF04384; DUF528 |
Protein Iron-sulfur cluster assembly protein IscX [140321] (1 species) formerly hypothetical protein YfhJ |
Species Escherichia coli [TaxId:562] [140322] (1 PDB entry) |
Domain d1uj8a1: 1uj8 A:13-76 [119683] |
PDB Entry: 1uj8 (more details), 1.75 Å
SCOP Domain Sequences for d1uj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj8a1 a.159.5.1 (A:13-76) Iron-sulfur cluster assembly protein IscX {Escherichia coli [TaxId: 562]} glkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillvw ldea
Timeline for d1uj8a1: