Lineage for d1uj8a1 (1uj8 A:13-76)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650429Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 650451Superfamily a.159.5: IscX-like [140319] (1 family) (S)
  5. 650452Family a.159.5.1: IscX-like [140320] (1 protein)
    Pfam PF04384; DUF528
  6. 650453Protein Iron-sulfur cluster assembly protein IscX [140321] (1 species)
    formerly hypothetical protein YfhJ
  7. 650454Species Escherichia coli [TaxId:562] [140322] (1 PDB entry)
  8. 650455Domain d1uj8a1: 1uj8 A:13-76 [119683]

Details for d1uj8a1

PDB Entry: 1uj8 (more details), 1.75 Å

PDB Description: Structures of ORF3 in Two Crystal Forms, a Member of Isc Machinery of E. coli Involved in the Assembly of Iron-Sulfur Clusters
PDB Compounds: (A:) Hypothetical protein yfhJ

SCOP Domain Sequences for d1uj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj8a1 a.159.5.1 (A:13-76) Iron-sulfur cluster assembly protein IscX {Escherichia coli [TaxId: 562]}
glkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillvw
ldea

SCOP Domain Coordinates for d1uj8a1:

Click to download the PDB-style file with coordinates for d1uj8a1.
(The format of our PDB-style files is described here.)

Timeline for d1uj8a1: