SCOPe 2.08: Domain d1uj8a1: 1uj8 A:13-76

Lineage for d1uj8a1 (1uj8 A:13-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.5: IscX-like [140319] (1 family)
   automatically mapped to Pfam PF04384

5. Family a.159.5.1: IscX-like [140320] (2 proteins)
   Pfam PF04384; DUF528

6. Protein Iron-sulfur cluster assembly protein IscX [140321] (1 species)
   formerly hypothetical protein YfhJ

7. Species Escherichia coli [TaxId:562] [140322] (1 PDB entry)
   Uniprot P0C0L9 2-65

8. Domain d1uj8a1: 1uj8 A:13-76 [119683]
   Other proteins in same PDB: d1uj8a2

Details for d1uj8a1

PDB Entry: 1uj8, 1.75 Å

PDB Description: Structures of ORF3 in Two Crystal Forms, a Member of Isc Machinery of E. coli Involved in the Assembly of Iron-Sulfur Clusters

PDB Compounds: (A:) Hypothetical protein yfhJ

SCOPe Domain Sequences for d1uj8a1:

Sequence; same for both SEQRES and ATOM records:

>d1uj8a1 a.159.5.1 (A:13-76) Iron-sulfur cluster assembly protein IscX {Escherichia coli [TaxId: 562]}
glkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillvw
ldea

Timeline for d1uj8a1:

• d1uj8a1 first appeared in SCOP 1.73
  
• d1uj8a1 appears in SCOPe 2.07