Lineage for d1uj8a1 (1uj8 A:13-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013855Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2013902Superfamily a.159.5: IscX-like [140319] (1 family) (S)
    automatically mapped to Pfam PF04384
  5. 2013903Family a.159.5.1: IscX-like [140320] (2 protein domains)
    Pfam PF04384; DUF528
  6. 2013904Protein Iron-sulfur cluster assembly protein IscX [140321] (1 species)
    formerly hypothetical protein YfhJ
  7. 2013905Species Escherichia coli [TaxId:562] [140322] (1 PDB entry)
    Uniprot P0C0L9 2-65
  8. 2013906Domain d1uj8a1: 1uj8 A:13-76 [119683]
    Other proteins in same PDB: d1uj8a2

Details for d1uj8a1

PDB Entry: 1uj8 (more details), 1.75 Å

PDB Description: Structures of ORF3 in Two Crystal Forms, a Member of Isc Machinery of E. coli Involved in the Assembly of Iron-Sulfur Clusters
PDB Compounds: (A:) Hypothetical protein yfhJ

SCOPe Domain Sequences for d1uj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj8a1 a.159.5.1 (A:13-76) Iron-sulfur cluster assembly protein IscX {Escherichia coli [TaxId: 562]}
glkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillvw
ldea

SCOPe Domain Coordinates for d1uj8a1:

Click to download the PDB-style file with coordinates for d1uj8a1.
(The format of our PDB-style files is described here.)

Timeline for d1uj8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uj8a2