Lineage for d1uhkb2 (1uhk B:2-189)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711269Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries)
  8. 2711271Domain d1uhkb2: 1uhk B:2-189 [119682]
    Other proteins in same PDB: d1uhka3, d1uhkb3
    automated match to d1ej3a_
    complexed with czn

Details for d1uhkb2

PDB Entry: 1uhk (more details), 1.6 Å

PDB Description: Crystal structure of n-aequorin
PDB Compounds: (B:) Aequorin 2

SCOPe Domain Sequences for d1uhkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhkb2 a.39.1.5 (B:2-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda
veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn
gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace
klyggavp

SCOPe Domain Coordinates for d1uhkb2:

Click to download the PDB-style file with coordinates for d1uhkb2.
(The format of our PDB-style files is described here.)

Timeline for d1uhkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uhkb3