Lineage for d1uhja_ (1uhj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711269Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries)
  8. 2711274Domain d1uhja_: 1uhj A: [119679]
    Other proteins in same PDB: d1uhjb3
    automated match to d1ej3a_
    complexed with czb

Details for d1uhja_

PDB Entry: 1uhj (more details), 1.8 Å

PDB Description: Crystal structure of br-aequorin
PDB Compounds: (A:) Aequorin 2

SCOPe Domain Sequences for d1uhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhja_ a.39.1.5 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOPe Domain Coordinates for d1uhja_:

Click to download the PDB-style file with coordinates for d1uhja_.
(The format of our PDB-style files is described here.)

Timeline for d1uhja_: