Lineage for d1uhib1 (1uhi B:3-189)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640903Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 640914Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (5 PDB entries)
  8. 640922Domain d1uhib1: 1uhi B:3-189 [119678]
    automatically matched to d1ej3a_
    complexed with czi

Details for d1uhib1

PDB Entry: 1uhi (more details), 1.8 Å

PDB Description: Crystal structure of i-aequorin
PDB Compounds: (B:) Aequorin 2

SCOP Domain Sequences for d1uhib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhib1 a.39.1.5 (B:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOP Domain Coordinates for d1uhib1:

Click to download the PDB-style file with coordinates for d1uhib1.
(The format of our PDB-style files is described here.)

Timeline for d1uhib1: