Lineage for d1ug3b2 (1ug3 B:1438-1564)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775465Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 775495Protein Eukaryotic initiation factor eIF4G [48388] (1 species)
  7. 775496Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)
  8. 775500Domain d1ug3b2: 1ug3 B:1438-1564 [119674]
    automatically matched to 1UG3 A:1438-1564
    mutant

Details for d1ug3b2

PDB Entry: 1ug3 (more details), 2.24 Å

PDB Description: c-terminal portion of human eif4gi
PDB Compounds: (B:) eukaryotic protein synthesis initiation factor 4G

SCOP Domain Sequences for d1ug3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug3b2 a.118.1.14 (B:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp
lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk
edafysw

SCOP Domain Coordinates for d1ug3b2:

Click to download the PDB-style file with coordinates for d1ug3b2.
(The format of our PDB-style files is described here.)

Timeline for d1ug3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ug3b1