| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
| Protein Eukaryotic initiation factor eIF4G [48388] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries) |
| Domain d1ug3b2: 1ug3 B:1438-1566 [119674] automated match to d1ug3a2 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1ug3 (more details), 2.24 Å
SCOPe Domain Sequences for d1ug3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug3b2 a.118.1.14 (B:1438-1566) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp
lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk
edafyswes
Timeline for d1ug3b2: