SCOPe 2.01: Domain d1ug3b1: 1ug3 B:1235-1427

Lineage for d1ug3b1 (1ug3 B:1235-1427)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Eukaryotic initiation factor eIF4G [48388] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)

8. Domain d1ug3b1: 1ug3 B:1235-1427 [119673]
   automatically matched to 1UG3 A:1235-1427

Details for d1ug3b1

PDB Entry: 1ug3, 2.24 Å

PDB Description: c-terminal portion of human eif4gi

PDB Compounds: (B:) eukaryotic protein synthesis initiation factor 4G

SCOPe Domain Sequences for d1ug3b1:

Sequence; same for both SEQRES and ATOM records:

>d1ug3b1 a.118.1.14 (B:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
kaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersaia
rehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqeggv
pmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqdi
gafvaeqkveytl

Timeline for d1ug3b1:

• d1ug3b1 first appeared in SCOP 1.73
  
• d1ug3b1 appears in SCOP 1.75
  
• d1ug3b1 appears in SCOPe 2.02
  
• d1ug3b1 appears in the current release, SCOPe 2.08