SCOP 1.73: Domain d1ug3a2: 1ug3 A:1438-1564

Lineage for d1ug3a2 (1ug3 A:1438-1564)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (22 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Eukaryotic initiation factor eIF4G [48388] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)

8. Domain d1ug3a2: 1ug3 A:1438-1564 [119672]
   gamma 3 isoform; C-terminal domain, containing a W2 region (Pfam PF02020)
   mutant

Details for d1ug3a2

PDB Entry: 1ug3, 2.24 Å

PDB Description: c-terminal portion of human eif4gi

PDB Compounds: (A:) eukaryotic protein synthesis initiation factor 4G

SCOP Domain Sequences for d1ug3a2:

Sequence; same for both SEQRES and ATOM records:

>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp
lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk
edafysw

Timeline for d1ug3a2:

• d1ug3a2 is new in SCOP 1.73
  
• d1ug3a2 appears in SCOP 1.75
  
• d1ug3a2 appears in the current release, SCOPe 2.08