Class a: All alpha proteins [46456] (258 folds) |
Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (22 families) |
Family a.118.1.14: MIF4G domain-like [100908] (5 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
Protein Eukaryotic initiation factor eIF4G [48388] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries) |
Domain d1ug3a2: 1ug3 A:1438-1564 [119672] gamma 3 isoform; C-terminal domain, containing a W2 region (Pfam PF02020) mutant |
PDB Entry: 1ug3 (more details), 2.24 Å
SCOP Domain Sequences for d1ug3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk edafysw
Timeline for d1ug3a2: