Lineage for d1ug3a2 (1ug3 A:1438-1564)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006716Family a.118.1.14: MIF4G domain-like [100908] (6 protein domains)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
  6. 2006746Protein Eukaryotic initiation factor eIF4G [48388] (1 species)
  7. 2006747Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)
  8. 2006749Domain d1ug3a2: 1ug3 A:1438-1564 [119672]
    gamma 3 isoform; C-terminal domain, containing a W2 region (Pfam PF02020)

Details for d1ug3a2

PDB Entry: 1ug3 (more details), 2.24 Å

PDB Description: C-terminal portion of human eIF4GI
PDB Compounds: (A:) eukaryotic protein synthesis initiation factor 4G

SCOPe Domain Sequences for d1ug3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp
lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk
edafysw

SCOPe Domain Coordinates for d1ug3a2:

Click to download the PDB-style file with coordinates for d1ug3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ug3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ug3a1