![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (22 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (5 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein Eukaryotic initiation factor eIF4G [48388] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries) |
![]() | Domain d1ug3a1: 1ug3 A:1235-1427 [119671] gamma 3 isoform; pre C-terminal domain, containing MA3 region (Pfam PF02847) mutant |
PDB Entry: 1ug3 (more details), 2.24 Å
SCOP Domain Sequences for d1ug3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} kaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersaia rehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqeggv pmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqdi gafvaeqkveytl
Timeline for d1ug3a1: