SCOP 1.73: Domain d1u9zd1: 1u9z D:1-155

Lineage for d1u9zd1 (1u9z D:1-155)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries)

8. Domain d1u9zd1: 1u9z D:1-155 [119669]
   automatically matched to 1U9Y A:1-155
   complexed with amp, r5p

Details for d1u9zd1

PDB Entry: 1u9z, 2.8 Å

PDB Description: crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate

PDB Compounds: (D:) Ribose-phosphate pyrophosphokinase

SCOP Domain Sequences for d1u9zd1:

Sequence; same for both SEQRES and ATOM records:

>d1u9zd1 c.61.1.2 (D:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
tinphethikdfftipfiygdavpklaeyvkdkln

Timeline for d1u9zd1:

• d1u9zd1 is new in SCOP 1.73
  
• d1u9zd1 appears in SCOP 1.75
  
• d1u9zd1 appears in the current release, SCOPe 2.08