SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1u9za2 (1u9z A:156-284)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128650Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 protein domains)
    duplication: consists of two domains of this fold
  6. 2128651Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)
  7. 2128665Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries)
    Uniprot Q58761 1-155! Uniprot Q58761 156-284
  8. 2128675Domain d1u9za2: 1u9z A:156-284 [119664]
    automated match to d1u9ya2
    complexed with amp, r5p

Details for d1u9za2

PDB Entry: 1u9z (more details), 2.8 Å

PDB Description: Crystal Structure of Phosphoribosyl Diphosphate Synthase Complexed with AMP and Ribose 5-Phosphate
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d1u9za2:

Sequence, based on SEQRES records: (download)

>d1u9za2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
dpivlapdkgalefaktaskilnaeydylektrlspteiqiapktldakdrdvfivddii
stggtmatavkllkeqgakkiiaacvhpvligdalnklysagveevvgtdtylsevskvs
vaevivdll

Sequence, based on observed residues (ATOM records): (download)

>d1u9za2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
dpivlapdkgalefaktaskilnaeydyleiapktldakdrdvfivddiistggtmatav
kllkeqgakkiiaacvhpvligdalnklysagveevvgtdtylsevskvsvaevivdll

SCOPe Domain Coordinates for d1u9za2:

Click to download the PDB-style file with coordinates for d1u9za2.
(The format of our PDB-style files is described here.)

Timeline for d1u9za2: