Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (2 families) |
Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species) |
Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries) |
Domain d1u9yd1: 1u9y D:1-155 [119661] automatically matched to 1U9Y A:1-155 |
PDB Entry: 1u9y (more details), 2.65 Å
SCOP Domain Sequences for d1u9yd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9yd1 c.61.1.2 (D:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli tinphethikdfftipfiygdavpklaeyvkdkln
Timeline for d1u9yd1: