SCOPe 2.08: Domain d1u9yc1: 1u9y C:1-155

Lineage for d1u9yc1 (1u9y C:1-155)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries)
   Uniprot Q58761 1-155! Uniprot Q58761 156-284

8. Domain d1u9yc1: 1u9y C:1-155 [119659]
   automated match to d1u9ya1

Details for d1u9yc1

PDB Entry: 1u9y, 2.65 Å

PDB Description: Crystal Structure of Phosphoribosyl Diphosphate Synthase from Methanocaldococcus jannaschii

PDB Compounds: (C:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d1u9yc1:

Sequence; same for both SEQRES and ATOM records:

>d1u9yc1 c.61.1.2 (C:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
tinphethikdfftipfiygdavpklaeyvkdkln

Timeline for d1u9yc1:

• d1u9yc1 first appeared in SCOP 1.73
  
• d1u9yc1 appears in SCOPe 2.07