![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
![]() | Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species) |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries) Uniprot Q58761 1-155! Uniprot Q58761 156-284 |
![]() | Domain d1u9yc1: 1u9y C:1-155 [119659] automated match to d1u9ya1 |
PDB Entry: 1u9y (more details), 2.65 Å
SCOPe Domain Sequences for d1u9yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9yc1 c.61.1.2 (C:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli tinphethikdfftipfiygdavpklaeyvkdkln
Timeline for d1u9yc1: