SCOPe 2.02: Domain d1u9xa1: 1u9x A:1-215

Lineage for d1u9xa1 (1u9x A:1-215)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (39 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1u9xa1: 1u9x A:1-215 [119654]
   automatically matched to d1atk__
   complexed with ihj

Details for d1u9xa1

PDB Entry: 1u9x, 2.1 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abj688

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1u9xa1:

Sequence; same for both SEQRES and ATOM records:

>d1u9xa1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1u9xa1:

• d1u9xa1 first appeared in SCOP 1.73
  
• d1u9xa1 appears in SCOPe 2.01
  
• d1u9xa1 is called d1u9xa_ in SCOPe 2.03
  
• d1u9xa1 appears in the current release, SCOPe 2.08, called d1u9xa_