Lineage for d1u9qx1 (1u9q X:1-212)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851270Family d.3.1.1: Papain-like [54002] (25 proteins)
  6. 851448Protein Cruzain [54020] (1 species)
  7. 851449Species Trypanosoma cruzi [TaxId:5693] [54021] (15 PDB entries)
  8. 851467Domain d1u9qx1: 1u9q X:1-212 [119650]
    automatically matched to d1ewla_
    complexed with 186

Details for d1u9qx1

PDB Entry: 1u9q (more details), 2.3 Å

PDB Description: crystal structure of cruzain bound to an alpha-ketoester
PDB Compounds: (X:) Cruzipain

SCOP Domain Sequences for d1u9qx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9qx1 d.3.1.1 (X:1-212) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOP Domain Coordinates for d1u9qx1:

Click to download the PDB-style file with coordinates for d1u9qx1.
(The format of our PDB-style files is described here.)

Timeline for d1u9qx1: