SCOP 1.73: Domain d1u9qx1: 1u9q X:1-212

Lineage for d1u9qx1 (1u9q X:1-212)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (13 PDB entries)

8. Domain d1u9qx1: 1u9q X:1-212 [119650]
   automatically matched to d1ewla_
   complexed with 186

Details for d1u9qx1

PDB Entry: 1u9q, 2.3 Å

PDB Description: crystal structure of cruzain bound to an alpha-ketoester

PDB Compounds: (X:) Cruzipain

SCOP Domain Sequences for d1u9qx1:

Sequence; same for both SEQRES and ATOM records:

>d1u9qx1 d.3.1.1 (X:1-212) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d1u9qx1:

• d1u9qx1 is new in SCOP 1.73
  
• d1u9qx1 appears in SCOP 1.75
  
• d1u9qx1 appears in the current release, SCOPe 2.08, called d1u9qx_