Lineage for d1u9pa1 (1u9p A:72-107)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996372Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996373Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1996580Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1996581Protein automated matches [230595] (4 species)
    not a true protein
  7. 1996582Species Escherichia coli [TaxId:562] [254910] (1 PDB entry)
  8. 1996583Domain d1u9pa1: 1u9p A:72-107 [119649]
    automated match to d1bazc_

Details for d1u9pa1

PDB Entry: 1u9p (more details), 1.9 Å

PDB Description: Permuted single-chain Arc
PDB Compounds: (A:) pArc

SCOPe Domain Sequences for d1u9pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9pa1 a.43.1.0 (A:72-107) automated matches {Escherichia coli [TaxId: 562]}
revldlvrkvaeengrsvnseiyqrvmesfkkegri

SCOPe Domain Coordinates for d1u9pa1:

Click to download the PDB-style file with coordinates for d1u9pa1.
(The format of our PDB-style files is described here.)

Timeline for d1u9pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u9pa2