SCOPe 2.08: Domain d1u9pa1: 1u9p A:72-107

Lineage for d1u9pa1 (1u9p A:72-107)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.0: automated matches [230594] (1 protein)
   not a true family

6. Protein automated matches [230595] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254910] (1 PDB entry)

8. Domain d1u9pa1: 1u9p A:72-107 [119649]
   automated match to d1bazc_

Details for d1u9pa1

PDB Entry: 1u9p, 1.9 Å

PDB Description: Permuted single-chain Arc

PDB Compounds: (A:) pArc

SCOPe Domain Sequences for d1u9pa1:

Sequence; same for both SEQRES and ATOM records:

>d1u9pa1 a.43.1.0 (A:72-107) automated matches {Escherichia coli [TaxId: 562]}
revldlvrkvaeengrsvnseiyqrvmesfkkegri

Timeline for d1u9pa1:

• d1u9pa1 first appeared in SCOP 1.73
  
• d1u9pa1 appears in SCOPe 2.07