SCOP 1.73: Domain d1u9if2: 1u9i F:256-497

Lineage for d1u9if2 (1u9i F:256-497)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Circadian clock protein KaiC [110558] (1 species)
   duplication: contains two copies of this domain

7. Species Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId:1140] [110559] (3 PDB entries)

8. Domain d1u9if2: 1u9i F:256-497 [119648]
   automatically matched to d1tf7a2
   complexed with atp, mg; mutant

Details for d1u9if2

PDB Entry: 1u9i, 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC with Phosphorylation Sites

PDB Compounds: (F:) KaiC

SCOP Domain Sequences for d1u9if2:

Sequence; same for both SEQRES and ATOM records:

>d1u9if2 c.37.1.11 (F:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}
qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf
ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari
aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd
tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt
ri

Timeline for d1u9if2:

• d1u9if2 is new in SCOP 1.73
  
• d1u9if2 appears in SCOP 1.75
  
• d1u9if2 appears in the current release, SCOPe 2.08