Lineage for d1u9ic1 (1u9i C:14-255)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869676Protein Circadian clock protein KaiC [110558] (1 species)
    duplication: contains two copies of this domain
  7. 2869677Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries)
    Uniprot Q79PF4 14-497
  8. 2869694Domain d1u9ic1: 1u9i C:14-255 [119641]
    automatically matched to d1tf7a1
    complexed with atp, mg

Details for d1u9ic1

PDB Entry: 1u9i (more details), 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC with Phosphorylation Sites
PDB Compounds: (C:) KaiC

SCOPe Domain Sequences for d1u9ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9ic1 c.37.1.11 (C:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
lt

SCOPe Domain Coordinates for d1u9ic1:

Click to download the PDB-style file with coordinates for d1u9ic1.
(The format of our PDB-style files is described here.)

Timeline for d1u9ic1: