Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Circadian clock protein KaiC [110558] (1 species) duplication: contains two copies of this domain |
Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries) Uniprot Q79PF4 14-497 |
Domain d1u9ic1: 1u9i C:14-255 [119641] automatically matched to d1tf7a1 complexed with atp, mg |
PDB Entry: 1u9i (more details), 2.8 Å
SCOPe Domain Sequences for d1u9ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9ic1 c.37.1.11 (C:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]} ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr lt
Timeline for d1u9ic1: