SCOPe 2.08: Domain d1u9ib2: 1u9i B:256-497

Lineage for d1u9ib2 (1u9i B:256-497)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Circadian clock protein KaiC [110558] (1 species)
   duplication: contains two copies of this domain

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries)
   Uniprot Q79PF4 14-497

8. Domain d1u9ib2: 1u9i B:256-497 [119640]
   automatically matched to d1tf7a2
   complexed with atp, mg

Details for d1u9ib2

PDB Entry: 1u9i, 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC with Phosphorylation Sites

PDB Compounds: (B:) KaiC

SCOPe Domain Sequences for d1u9ib2:

Sequence; same for both SEQRES and ATOM records:

>d1u9ib2 c.37.1.11 (B:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf
ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari
aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd
tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt
ri

Timeline for d1u9ib2:

• d1u9ib2 first appeared in SCOP 1.73
  
• d1u9ib2 appears in SCOPe 2.07