SCOPe 2.05: Domain d1u8ua_: 1u8u A:

Lineage for d1u8ua_ (1u8u A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.5: TAP-like [89594] (2 proteins)
   automatically mapped to Pfam PF00657
   automatically mapped to Pfam PF13472

6. Protein Thioesterase I, TAP [89595] (1 species)
   multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities

7. Species Escherichia coli [TaxId:562] [89596] (5 PDB entries)
   Uniprot P29679 27-205

8. Domain d1u8ua_: 1u8u A: [119634]
   automated match to d1ivna_
   complexed with gol, oca, so4

Details for d1u8ua_

PDB Entry: 1u8u, 2.08 Å

PDB Description: E. coli Thioesterase I/Protease I/Lysophospholiase L1 in complexed with octanoic acid

PDB Compounds: (A:) Acyl-CoA Thioesterase I

SCOPe Domain Sequences for d1u8ua_:

Sequence, based on SEQRES records:

>d1u8ua_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh

Sequence, based on observed residues (ATOM records):

>d1u8ua_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvh

Timeline for d1u8ua_:

• d1u8ua_ first appeared in SCOP 1.73, called d1u8ua1
  
• d1u8ua_ appears in SCOPe 2.04
  
• d1u8ua_ appears in SCOPe 2.06
  
• d1u8ua_ appears in the current release, SCOPe 2.08