Lineage for d1u8ua1 (1u8u A:1-180)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826290Superfamily c.23.10: SGNH hydrolase [52266] (9 families) (S)
  5. 826338Family c.23.10.5: TAP-like [89594] (2 proteins)
  6. 826342Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 826343Species Escherichia coli [TaxId:562] [89596] (5 PDB entries)
    Uniprot P29679 27-205
  8. 826347Domain d1u8ua1: 1u8u A:1-180 [119634]
    automatically matched to d1ivna_
    complexed with gol, oca, so4

Details for d1u8ua1

PDB Entry: 1u8u (more details), 2.08 Å

PDB Description: E. coli Thioesterase I/Protease I/Lysophospholiase L1 in complexed with octanoic acid
PDB Compounds: (A:) Acyl-CoA Thioesterase I

SCOP Domain Sequences for d1u8ua1:

Sequence, based on SEQRES records: (download)

>d1u8ua1 c.23.10.5 (A:1-180) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh

Sequence, based on observed residues (ATOM records): (download)

>d1u8ua1 c.23.10.5 (A:1-180) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvh

SCOP Domain Coordinates for d1u8ua1:

Click to download the PDB-style file with coordinates for d1u8ua1.
(The format of our PDB-style files is described here.)

Timeline for d1u8ua1: