SCOPe 2.05: Domain d1u8fq2: 1u8f Q:152-315

Lineage for d1u8fq2 (1u8f Q:152-315)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Human (Homo sapiens), liver isoform [TaxId:9606] [143535] (2 PDB entries)
   Uniprot P04406 151-314

8. Domain d1u8fq2: 1u8f Q:152-315 [119631]
   Other proteins in same PDB: d1u8fo1, d1u8fp1, d1u8fq1, d1u8fr1
   automatically matched to 1ZNQ O:152-315
   complexed with nad

Details for d1u8fq2

PDB Entry: 1u8f, 1.75 Å

PDB Description: Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75 Resolution

PDB Compounds: (Q:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1u8fq2:

Sequence; same for both SEQRES and ATOM records:

>d1u8fq2 d.81.1.1 (Q:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
cttnclaplakvihdnfgiveglmttvhaitatqktvdgpsgklwrdgrgalqniipast
gaakavgkvipelngkltgmafrvptanvsvvdltcrlekpakyddikkvvkqasegplk
gilgytehqvvssdfnsdthsstfdagagialndhfvkliswyd

Timeline for d1u8fq2:

• d1u8fq2 first appeared in SCOP 1.73
  
• d1u8fq2 appears in SCOPe 2.04
  
• d1u8fq2 appears in SCOPe 2.06
  
• d1u8fq2 appears in the current release, SCOPe 2.08