Lineage for d1u8fo2 (1u8f O:152-315)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915891Species Human (Homo sapiens), liver isoform [TaxId:9606] [143535] (2 PDB entries)
    Uniprot P04406 151-314
  8. 1915892Domain d1u8fo2: 1u8f O:152-315 [119627]
    Other proteins in same PDB: d1u8fo1, d1u8fp1, d1u8fq1, d1u8fr1
    automatically matched to 1ZNQ O:152-315
    complexed with nad

Details for d1u8fo2

PDB Entry: 1u8f (more details), 1.75 Å

PDB Description: Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75 Resolution
PDB Compounds: (O:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1u8fo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
cttnclaplakvihdnfgiveglmttvhaitatqktvdgpsgklwrdgrgalqniipast
gaakavgkvipelngkltgmafrvptanvsvvdltcrlekpakyddikkvvkqasegplk
gilgytehqvvssdfnsdthsstfdagagialndhfvkliswyd

SCOPe Domain Coordinates for d1u8fo2:

Click to download the PDB-style file with coordinates for d1u8fo2.
(The format of our PDB-style files is described here.)

Timeline for d1u8fo2: