Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Human (Homo sapiens), liver isoform [TaxId:9606] [143535] (2 PDB entries) Uniprot P04406 151-314 |
Domain d1u8fo2: 1u8f O:152-315 [119627] Other proteins in same PDB: d1u8fo1, d1u8fp1, d1u8fq1, d1u8fr1 automatically matched to 1ZNQ O:152-315 complexed with nad |
PDB Entry: 1u8f (more details), 1.75 Å
SCOPe Domain Sequences for d1u8fo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]} cttnclaplakvihdnfgiveglmttvhaitatqktvdgpsgklwrdgrgalqniipast gaakavgkvipelngkltgmafrvptanvsvvdltcrlekpakyddikkvvkqasegplk gilgytehqvvssdfnsdthsstfdagagialndhfvkliswyd
Timeline for d1u8fo2: