Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Human (Homo sapiens), liver isoform [TaxId:9606] [141915] (2 PDB entries) Uniprot P04406 2-150,315-334 |
Domain d1u8fo1: 1u8f O:3-151,O:316-335 [119626] Other proteins in same PDB: d1u8fo2, d1u8fp2, d1u8fq2, d1u8fr2 automatically matched to 1ZNQ O:3-151,O:316-335 complexed with nad |
PDB Entry: 1u8f (more details), 1.75 Å
SCOPe Domain Sequences for d1u8fo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]} kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis apsadapmfvmgvnhekydnslkiisnasXnefgysnrvvdlmahmaske
Timeline for d1u8fo1: