SCOPe 2.02: Domain d1u8fo1: 1u8f O:3-151,O:316-335

Lineage for d1u8fo1 (1u8f O:3-151,O:316-335)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Human (Homo sapiens), liver isoform [TaxId:9606] [141915] (2 PDB entries)
   Uniprot P04406 2-150,315-334

8. Domain d1u8fo1: 1u8f O:3-151,O:316-335 [119626]
   Other proteins in same PDB: d1u8fo2, d1u8fp2, d1u8fq2, d1u8fr2
   automatically matched to 1ZNQ O:3-151,O:316-335
   complexed with nad

Details for d1u8fo1

PDB Entry: 1u8f, 1.75 Å

PDB Description: Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75 Resolution

PDB Compounds: (O:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1u8fo1:

Sequence; same for both SEQRES and ATOM records:

>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
apsadapmfvmgvnhekydnslkiisnasXnefgysnrvvdlmahmaske

Timeline for d1u8fo1:

• d1u8fo1 first appeared in SCOP 1.73
  
• d1u8fo1 appears in SCOPe 2.01
  
• d1u8fo1 appears in SCOPe 2.03
  
• d1u8fo1 appears in the current release, SCOPe 2.08