SCOPe 2.07: Domain d1u86a1: 1u86 A:3-35

Lineage for d1u86a1 (1u86 A:3-35)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Kruppel-like factor 3, Bklf [103597] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries)

8. Domain d1u86a1: 1u86 A:3-35 [119624]
   Other proteins in same PDB: d1u86a2
   complexed with zn; mutant

Details for d1u86a1

PDB Entry: 1u86

PDB Description: 321-tw-322 insertion mutant of the third zinc finger of bklf

PDB Compounds: (A:) Kruppel-like factor 3

SCOPe Domain Sequences for d1u86a1:

Sequence; same for both SEQRES and ATOM records:

>d1u86a1 g.37.1.1 (A:3-35) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
tgikpfqctwpdcdrsfsrsdhlalhrkrhmlv

Timeline for d1u86a1:

• d1u86a1 first appeared in SCOP 1.73
  
• d1u86a1 appears in SCOPe 2.06
  
• d1u86a1 appears in the current release, SCOPe 2.08