Lineage for d1u86a1 (1u86 A:3-35)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035191Protein Kruppel-like factor 3, Bklf [103597] (1 species)
  7. 3035192Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries)
  8. 3035195Domain d1u86a1: 1u86 A:3-35 [119624]
    Other proteins in same PDB: d1u86a2
    complexed with zn; mutant

Details for d1u86a1

PDB Entry: 1u86 (more details)

PDB Description: 321-tw-322 insertion mutant of the third zinc finger of bklf
PDB Compounds: (A:) Kruppel-like factor 3

SCOPe Domain Sequences for d1u86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u86a1 g.37.1.1 (A:3-35) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
tgikpfqctwpdcdrsfsrsdhlalhrkrhmlv

SCOPe Domain Coordinates for d1u86a1:

Click to download the PDB-style file with coordinates for d1u86a1.
(The format of our PDB-style files is described here.)

Timeline for d1u86a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u86a2