Lineage for d1u7mb1 (1u7m B:1-53)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047948Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 3047949Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 3047950Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 3047951Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 3047952Species Synthetic, different variants [58838] (12 PDB entries)
  8. 3047992Domain d1u7mb1: 1u7m B:1-53 [119620]
    automatically matched to 1U7M A:1-53
    complexed with zn; mutant

Details for d1u7mb1

PDB Entry: 1u7m (more details)

PDB Description: solution structure of a diiron protein model: due ferri(ii) turn mutant
PDB Compounds: (B:) Four-helix bundle model

SCOPe Domain Sequences for d1u7mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7mb1 k.8.1.1 (B:1-53) Artificial diiron protein {Synthetic, different variants}
mdylrelykleqqamklyreasekarnpekksvlqkiledeekhiewleting

SCOPe Domain Coordinates for d1u7mb1:

Click to download the PDB-style file with coordinates for d1u7mb1.
(The format of our PDB-style files is described here.)

Timeline for d1u7mb1: