SCOPe 2.08: Domain d1u7jb1: 1u7j B:1-49

Lineage for d1u7jb1 (1u7j B:1-49)

1. Root: SCOPe 2.08

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)

4. Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family)

5. Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
   this is not a true family

6. Protein Artificial diiron protein [58837] (1 species)
   dimeric alpha-hairpin fold

7. Species Synthetic, different variants [58838] (12 PDB entries)

8. Domain d1u7jb1: 1u7j B:1-49 [119618]
   automatically matched to 1U7J A:1-49
   complexed with zn

Details for d1u7jb1

PDB Entry: 1u7j

PDB Description: solution structure of a diiron protein model

PDB Compounds: (B:) Four-helix bundle model

SCOPe Domain Sequences for d1u7jb1:

Sequence; same for both SEQRES and ATOM records:

>d1u7jb1 k.8.1.1 (B:1-49) Artificial diiron protein {Synthetic, different variants}
mdylrelykleqqamklyreaservgdpvlakiledeekhiewleting

Timeline for d1u7jb1:

• d1u7jb1 first appeared in SCOP 1.73
  
• d1u7jb1 appears in SCOPe 2.07