Lineage for d1u7db1 (1u7d B:2-306)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693496Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (5 species)
  7. 693497Species Archaeon Methanococcus jannaschii [TaxId:2190] [89611] (2 PDB entries)
  8. 693500Domain d1u7db1: 1u7d B:2-306 [119616]
    automatically matched to d1j1ua_

Details for d1u7db1

PDB Entry: 1u7d (more details), 2.65 Å

PDB Description: crystal structure of apo M. jannashii tyrosyl-tRNA synthetase
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOP Domain Sequences for d1u7db1:

Sequence, based on SEQRES records: (download)

>d1u7db1 c.26.1.1 (B:2-306) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvndihylgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

Sequence, based on observed residues (ATOM records): (download)

>d1u7db1 c.26.1.1 (B:2-306) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarpkvaeviypimqvndihylgvdvavggmeihmlarellpkkvvcihnpvl
tgldgeggnfiavddspeeirakikkaycpagvvegnpimeiakyfleypltikrpekfg
gdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl

SCOP Domain Coordinates for d1u7db1:

Click to download the PDB-style file with coordinates for d1u7db1.
(The format of our PDB-style files is described here.)

Timeline for d1u7db1:

Domains from other chains:
(mouse over for more information)
d1u7da1