Lineage for d1u7db_ (1u7d B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105577Species Methanococcus jannaschii [TaxId:2190] [89611] (9 PDB entries)
  8. 2105587Domain d1u7db_: 1u7d B: [119616]
    automated match to d1j1ua_

Details for d1u7db_

PDB Entry: 1u7d (more details), 2.65 Å

PDB Description: crystal structure of apo M. jannashii tyrosyl-tRNA synthetase
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1u7db_:

Sequence, based on SEQRES records: (download)

>d1u7db_ c.26.1.1 (B:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvndihylgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

Sequence, based on observed residues (ATOM records): (download)

>d1u7db_ c.26.1.1 (B:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarpkvaeviypimqvndihylgvdvavggmeihmlarellpkkvvcihnpvl
tgldgeggnfiavddspeeirakikkaycpagvvegnpimeiakyfleypltikrpekfg
gdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl

SCOPe Domain Coordinates for d1u7db_:

Click to download the PDB-style file with coordinates for d1u7db_.
(The format of our PDB-style files is described here.)

Timeline for d1u7db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u7da_