Lineage for d1u6rb1 (1u6r B:7-101)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772927Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 772928Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 772929Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 772940Protein Creatine kinase, N-domain [48036] (7 species)
  7. 772970Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries)
  8. 772972Domain d1u6rb1: 1u6r B:7-101 [119602]
    Other proteins in same PDB: d1u6ra2, d1u6rb2
    automatically matched to d2crka1
    complexed with adp, iom, mg, no3; mutant

Details for d1u6rb1

PDB Entry: 1u6r (more details), 1.65 Å

PDB Description: transition state analog complex of muscle creatine kinase (r134k) mutant
PDB Compounds: (B:) Creatine kinase, M chain

SCOP Domain Sequences for d1u6rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6rb1 a.83.1.1 (B:7-101) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgvdnpghp
fimtvgcvagdeesytvfkdlfdpiiqdrhggfkp

SCOP Domain Coordinates for d1u6rb1:

Click to download the PDB-style file with coordinates for d1u6rb1.
(The format of our PDB-style files is described here.)

Timeline for d1u6rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6rb2