SCOPe 2.08: Domain d1u6ra2: 1u6r A:102-380

Lineage for d1u6ra2 (1u6r A:102-380)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
   automatically mapped to Pfam PF00217

6. Protein Creatine kinase, C-terminal domain [55936] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55940] (2 PDB entries)

8. Domain d1u6ra2: 1u6r A:102-380 [119601]
   Other proteins in same PDB: d1u6ra1, d1u6rb1
   automated match to d1g0wa2
   complexed with adp, iom, mg, no3; mutant

Details for d1u6ra2

PDB Entry: 1u6r, 1.65 Å

PDB Description: transition state analog complex of muscle creatine kinase (r134k) mutant

PDB Compounds: (A:) Creatine kinase, M chain

SCOPe Domain Sequences for d1u6ra2:

Sequence; same for both SEQRES and ATOM records:

>d1u6ra2 d.128.1.2 (A:102-380) Creatine kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdkhktdlnhenlkggddldphyvlssrvrtgksikgytlpphcsrgerraveklsveal
nsltgefkgkyyplksmteqeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ksflvwvneedhlrvismekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvlt
cpsnlgtglrggvhvklahlskhpkfeeiltrlrlqkrgtggvdtaavgsvfdisnadrl
gsseveqvqlvvdgvklmvemekklekgqsiddmipaqk

Timeline for d1u6ra2:

• d1u6ra2 first appeared in SCOP 1.73
  
• d1u6ra2 appears in SCOPe 2.07