Lineage for d1u6ra1 (1u6r A:1-101)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332344Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2332345Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2332346Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2332374Protein Creatine kinase, N-domain [48036] (7 species)
  7. 2332406Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries)
  8. 2332407Domain d1u6ra1: 1u6r A:1-101 [119600]
    Other proteins in same PDB: d1u6ra2, d1u6rb2
    automated match to d1g0wa1
    complexed with adp, iom, mg, no3; mutant

Details for d1u6ra1

PDB Entry: 1u6r (more details), 1.65 Å

PDB Description: transition state analog complex of muscle creatine kinase (r134k) mutant
PDB Compounds: (A:) Creatine kinase, M chain

SCOPe Domain Sequences for d1u6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ra1 a.83.1.1 (A:1-101) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
pfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgv
dnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkp

SCOPe Domain Coordinates for d1u6ra1:

Click to download the PDB-style file with coordinates for d1u6ra1.
(The format of our PDB-style files is described here.)

Timeline for d1u6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6ra2