SCOPe 2.08: Domain d1u6ra1: 1u6r A:1-101

Lineage for d1u6ra1 (1u6r A:1-101)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries)

8. Domain d1u6ra1: 1u6r A:1-101 [119600]
   Other proteins in same PDB: d1u6ra2, d1u6rb2
   automated match to d1g0wa1
   complexed with adp, iom, mg, no3; mutant

Details for d1u6ra1

PDB Entry: 1u6r, 1.65 Å

PDB Description: transition state analog complex of muscle creatine kinase (r134k) mutant

PDB Compounds: (A:) Creatine kinase, M chain

SCOPe Domain Sequences for d1u6ra1:

Sequence; same for both SEQRES and ATOM records:

>d1u6ra1 a.83.1.1 (A:1-101) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
pfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgv
dnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkp

Timeline for d1u6ra1:

• d1u6ra1 first appeared in SCOP 1.73
  
• d1u6ra1 appears in SCOPe 2.07