![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Creatine kinase, N-domain [48036] (7 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48040] (2 PDB entries) |
![]() | Domain d1u6ra1: 1u6r A:1-101 [119600] Other proteins in same PDB: d1u6ra2, d1u6rb2 automated match to d1g0wa1 complexed with adp, iom, mg, no3; mutant |
PDB Entry: 1u6r (more details), 1.65 Å
SCOPe Domain Sequences for d1u6ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6ra1 a.83.1.1 (A:1-101) Creatine kinase, N-domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} pfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgv dnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkp
Timeline for d1u6ra1: