SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1u6ia_ (1u6i A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151434Fold c.127: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102323] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213456
  4. 2151435Superfamily c.127.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102324] (1 family) (S)
    the sheet topology is similar to those of the Periplasmic binding protein-like I domains
    automatically mapped to Pfam PF01993
  5. 2151436Family c.127.1.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102325] (1 protein)
  6. 2151437Protein F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102326] (1 species)
  7. 2151438Species Methanopyrus kandleri [TaxId:2320] [102327] (7 PDB entries)
  8. 2151469Domain d1u6ia_: 1u6i A: [119573]
    automated match to d1qv9a_
    complexed with mg

Details for d1u6ia_

PDB Entry: 1u6i (more details), 2.2 Å

PDB Description: The Structure of native coenzyme F420-dependent methylenetetrahydromethanopterin dehydrogenase at 2.2A resolution
PDB Compounds: (A:) F420-dependent methylenetetrahydromethanopterin dehydrogenase

SCOPe Domain Sequences for d1u6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ia_ c.127.1.1 (A:) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Methanopyrus kandleri [TaxId: 2320]}
tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe

SCOPe Domain Coordinates for d1u6ia_:

Click to download the PDB-style file with coordinates for d1u6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1u6ia_: