Lineage for d1u6fa1 (1u6f A:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952160Protein RNA-binding protein UBP1 [143322] (1 species)
  7. 2952161Species Trypanosoma cruzi [TaxId:5693] [143323] (1 PDB entry)
    Uniprot Q967R0 1-139
  8. 2952162Domain d1u6fa1: 1u6f A:1-139 [119572]
    has additional insertions and/or extensions that are not grouped together

Details for d1u6fa1

PDB Entry: 1u6f (more details)

PDB Description: nmr solution structure of tcubp1, a single rbd-unit from trypanosoma cruzi
PDB Compounds: (A:) RNA-binding protein UBP1

SCOPe Domain Sequences for d1u6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}
msqiplvsqydpygqtaqlqqlqqqqqqhipptqmnpepdvlrnlmvnyipttvdevqlr
qlferygpiesvkivcdretrqsrgygfvkfqsgssaqqaiaglngfnilnkrlkvalaa
sghqrpgiagavgdgngyl

SCOPe Domain Coordinates for d1u6fa1:

Click to download the PDB-style file with coordinates for d1u6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1u6fa1: