![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein RNA-binding protein UBP1 [143322] (1 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [143323] (1 PDB entry) Uniprot Q967R0 1-139 |
![]() | Domain d1u6fa1: 1u6f A:1-139 [119572] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1u6f (more details)
SCOPe Domain Sequences for d1u6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} msqiplvsqydpygqtaqlqqlqqqqqqhipptqmnpepdvlrnlmvnyipttvdevqlr qlferygpiesvkivcdretrqsrgygfvkfqsgssaqqaiaglngfnilnkrlkvalaa sghqrpgiagavgdgngyl
Timeline for d1u6fa1: