Lineage for d1u6ea2 (1u6e A:175-317)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711668Family c.95.1.2: Chalcone synthase-like [53914] (8 protein domains)
  6. 711771Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 711799Species Mycobacterium tuberculosis [TaxId:1773] [64196] (6 PDB entries)
  8. 711801Domain d1u6ea2: 1u6e A:175-317 [119569]
    automatically matched to d1hzpa2
    complexed with cl; mutant

Details for d1u6ea2

PDB Entry: 1u6e (more details), 1.85 Å

PDB Description: 1.85 Angstrom Crystal Structure of the C112A Mutant of Mycobacterium Tuberculosis Beta-Ketoacyl-Acyl Carrier Protein Synthase III (FabH)
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOP Domain Sequences for d1u6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrm

SCOP Domain Coordinates for d1u6ea2:

Click to download the PDB-style file with coordinates for d1u6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1u6ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6ea1