![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (17 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
![]() | Domain d1u6al2: 1u6a L:108-213 [119567] Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al1 automated match to d3hi1a2 |
PDB Entry: 1u6a (more details), 2.81 Å
SCOPe Domain Sequences for d1u6al2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6al2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1u6al2: