Lineage for d1u6al2 (1u6a L:108-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517739Domain d1u6al2: 1u6a L:108-213 [119567]
    Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al1
    automated match to d3hi1a2

Details for d1u6al2

PDB Entry: 1u6a (more details), 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
PDB Compounds: (L:) f105 light chain

SCOPe Domain Sequences for d1u6al2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6al2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1u6al2:

Click to download the PDB-style file with coordinates for d1u6al2.
(The format of our PDB-style files is described here.)

Timeline for d1u6al2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6al1