Lineage for d1u6al2 (1u6a L:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656061Domain d1u6al2: 1u6a L:108-213 [119567]
    Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al1
    automatically matched to d1rhha2

Details for d1u6al2

PDB Entry: 1u6a (more details), 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
PDB Compounds: (L:) f105 light chain

SCOP Domain Sequences for d1u6al2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6al2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1u6al2:

Click to download the PDB-style file with coordinates for d1u6al2.
(The format of our PDB-style files is described here.)

Timeline for d1u6al2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6al1